Le forum de l'équipe de la science

Le forum qui parle de BOINC et de ses projets avec l'équipe de la science
 
AccueilPortailFAQRechercherS'enregistrerMembresGroupesConnexion

Partagez | 
 

 cypa

Voir le sujet précédent Voir le sujet suivant Aller en bas 
AuteurMessage
pas93
Webmestre
Webmestre
avatar

Nombre de messages : 4850
Age : 27
Localisation : seine-Saint-Denis(93) ( Le blanc-mesnil)
Date d'inscription : 01/11/2005

MessageSujet: cypa   Dim 27 Nov - 15:07

EN réapprovisionnant mon 2ghz en wu predictor je me suis apperçu qu'il télécharger un fichier de 6MB c'est une application pour pouvoir calculé les wu nomé cypa que j'ai immédiatement reçu avec l'application d'allieur à l'heure ou je vous parle le site est enconbréer je telecharger 1 wu à la foi et à une vitesse de 0.62kbps

Quel protein calculons nous:

Human Cyclophilin A
We are gathering data on peptide rotation geometry of the CypA substrate

1. Protein Name
Recombinant Cyclophilin A From Human T Cell
2. Organism Name
Homo Sapiens
3. Number of amino acids (approx)
160
4. Amino acid sequence
VNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGS
CFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMA
NAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGK
TSKKITIADCGQLE
5. Function
Peptidyl cis/trans isomerase
6. Experimental Method
X-ray diffraction
7. Experimental structure:
1RMH

Ceci vient quelque semaine après l'apparitions de la protein bprion pour la vache folle. Cela veut dire que le projet avance bien go team

_________________


Revenir en haut Aller en bas
Voir le profil de l'utilisateur http://edls.boinc.fr
gus
Webmestre
Webmestre
avatar

Nombre de messages : 1952
Localisation : Laval (près de Grenoble)
Date d'inscription : 01/11/2005

MessageSujet: Re: cypa   Dim 27 Nov - 22:06

that's good !

_________________
Revenir en haut Aller en bas
Voir le profil de l'utilisateur http://boinc-alpes.ifrance.com
Mephisto94
Explorateur
Explorateur
avatar

Nombre de messages : 227
Localisation : Region parisienne, très souvent en déplacement
Date d'inscription : 26/11/2005

MessageSujet: Re: cypa   Dim 27 Nov - 22:22

Moi aussi j'ai téléchargé 2 cypa aujourd'hui...

_________________


Revenir en haut Aller en bas
Voir le profil de l'utilisateur
pas93
Webmestre
Webmestre
avatar

Nombre de messages : 4850
Age : 27
Localisation : seine-Saint-Denis(93) ( Le blanc-mesnil)
Date d'inscription : 01/11/2005

MessageSujet: Re: cypa   Dim 27 Nov - 22:52

lol! un petit bug tu t'est enerver sur ton ordi à se que je vois un petit plantage lol! enfin FCCPU

Et tu as tu mis baucoup de temps pour les telecharger?

_________________


Revenir en haut Aller en bas
Voir le profil de l'utilisateur http://edls.boinc.fr
Mephisto94
Explorateur
Explorateur
avatar

Nombre de messages : 227
Localisation : Region parisienne, très souvent en déplacement
Date d'inscription : 26/11/2005

MessageSujet: Re: cypa   Lun 28 Nov - 0:37

lol j'avais pas vu mes 3 posts successifs... Si un des admins peut faire du menage, je le remercie d'avance, comme ça j'aurais l'air (un peu) moins bête!

Pour le DL des cypa, je viens de regarder le log... Ca s'est effectivement trainé à la vitesse d'un Internet asmathique, c'est à dire pas plus de 500 octets/s!

_________________


Revenir en haut Aller en bas
Voir le profil de l'utilisateur
pas93
Webmestre
Webmestre
avatar

Nombre de messages : 4850
Age : 27
Localisation : seine-Saint-Denis(93) ( Le blanc-mesnil)
Date d'inscription : 01/11/2005

MessageSujet: Re: cypa   Lun 28 Nov - 1:47

Oui à mon avie ils on réduis la vitesse de connexion du serveur pour les fichier cypa pour ne pas qu'il soit tous dévalisé en une journer.
Et oui je vais faire du trie pour tes post lol!

FCCPU go team france saut

_________________


Revenir en haut Aller en bas
Voir le profil de l'utilisateur http://edls.boinc.fr
gus
Webmestre
Webmestre
avatar

Nombre de messages : 1952
Localisation : Laval (près de Grenoble)
Date d'inscription : 01/11/2005

MessageSujet: Re: cypa   Lun 28 Nov - 14:51

moi toujours rien

en fait je ne regarde pas trop

_________________
Revenir en haut Aller en bas
Voir le profil de l'utilisateur http://boinc-alpes.ifrance.com
Contenu sponsorisé




MessageSujet: Re: cypa   

Revenir en haut Aller en bas
 
cypa
Voir le sujet précédent Voir le sujet suivant Revenir en haut 
Page 1 sur 1

Permission de ce forum:Vous ne pouvez pas répondre aux sujets dans ce forum
Le forum de l'équipe de la science :: Projets du domaine Biomédical :: Predictor@home-
Sauter vers: